SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000014270 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000014270
Domain Number 1 Region: 617-853
Classification Level Classification E-value
Superfamily HCP-like 2.79e-27
Family HCP-like 0.00069
Further Details:      
 
Domain Number 2 Region: 830-944
Classification Level Classification E-value
Superfamily HCP-like 0.000000000732
Family HCP-like 0.0087
Further Details:      
 
Domain Number 3 Region: 507-578
Classification Level Classification E-value
Superfamily HCP-like 0.000000106
Family HCP-like 0.011
Further Details:      
 
Domain Number 4 Region: 225-366
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000317
Family Alginate lyase 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000014270
Sequence length 1022
Comment (Anolis carolinensis)
Sequence
PSLGKKTFLTTPVILQPDDSVFYEDFIHLNVLDKRVRNDTEISVTYLCSKPCIVTIEAIA
SLEFRTGVSVYKKSWENNNHLHTTWNQTVNLTFPSSMVFRDDFVIKHSLIVHTVILYAWL
SHKQARVPHAKQEEGYLQAIARDYTLLDIVPPFERPHKDHKVCLKWSLEYTWRLQANRIP
WCPHETDAVEILNFPYASSGEMAGLVKKFPKFKNRELERIRKRQISSPNFTVSIWLYLLH
YCKKPLCGILYFIDSKEMYGSPAVFLNDEGCVHIQMHLVNGEDTAVKTTFSLPLKQWLRL
DLSVNGEQIEIRSVGTNLKIHQHEIFHFREDFYYNDTSGYLALGGSTYSPGIEGYFGTVK
YYRLHGLETERISNPFFSNEVLKRIDAYHQKCPAIQSIASKYGFTLRQGEEEQKCIRDNY
YLEMKNKYGGNLKCAEIIWEKELIGKHNSMSRQLQKADLHPQAANMTGSVPIFGRKLFVT
TLQNLSKDDGLHYINSSLQSLMDSSCLGYHRASYVLGVIFEIGLGMPTDPLQGLLYSLVA
AQGGDRLALMNLGYKHYQGINDYPRDLELSYAYYSDVAVKTPHDQNTAEGDQAFVEPVRL
QDDELLKAQTRESGDLFMWLKHEAKRGDAAAQQRLGQMLFWGQQGVGKNHKAAVEWYAKG
ALETGDPTSLYDYSIVLFKGQGVKKNKRRALQLMKKAASKGLPQAVNGLGWYYHNFQRDY
AKAAKYWLKAEAMGSPEASFNLGVLYLDGIYPGQTGRNHTVAADYFYKAAEGGHMEGTLR
CSQYYISGNLARFPRDPEKAVVWAKFVAEKNGYLGHVIRKALNAYLDLSWHEALLYYIFA
AETGIEVSQTNLAHLCEEQANLAKTYLATDCVWRYYNFSVFQSNAPTFAYLKVGDFYYYG
YQNQSRDLDMSIQMYSQAALNGDAQGFYNLATLLEEGYSIPSDILDHLEICRSLHTSNTA
LRQQLYERCCSLSNQESISPCTFALLYFHLRIFCSVWHSSLIYFLGSFLAFALVAFVIQC
FQ
Download sequence
Identical sequences 28377.ENSACAP00000014270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]