SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000014400 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000014400
Domain Number 1 Region: 1-176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.82e-26
Family Clostridium neurotoxins, the second last domain 0.058
Further Details:      
 
Domain Number 2 Region: 425-562
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000204
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.09
Further Details:      
 
Domain Number 3 Region: 259-365,454-507
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000205
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.09
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000014400
Domain Number - Region: 570-612,796-840
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000419
Family Fibronectin type III 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000014400
Sequence length 1100
Comment (Anolis carolinensis)
Sequence
LYFSGRREQLLLRPGALAELPRGTFTVEAWLRPEGGQSNPAIIAGVFDNCSHITSDRGWT
LGITSQEPRKKNARFFFSLRTDRIKKASTILAYHRYQLNAWVHVAATYDGHQMLLYLNGE
RVARSTQQWGDLHSRFMASCRTLILGGDNSGGHNFRGHLTSLTLWGIALPQEKLQRAFLR
KAEEYEAAILLNVRFSHLEQQWVHFQNGAYPLVESFHLLEPPVLSPLTPPLCGQTACDNV
ELISHYNNHWPLRNEKVVRYRVVNIYDDDGLHPTVSQEQITHQHRVLSEAFSHYNITWQL
HVHKVRSSLLRHRVVLMNCDPGKIANEFCNPECKHPLTGYDGGDCRRPGRCYSWQRRDGV
CNMECNNMFHNFDDGDCCNPKVTNVRKTCFDPDSPQRAYMSVKELKEALQLNSTHFLNVY
FATSVQEELAGAGTWPWDKDALSHLGGVVLNPVYYGVPGHTNTLIHEVGHVLGLYHVFKG
VDEKDSCDDPCRETTPSMETGDLCADTAPTPKSKLCRDPDPNNDICGQTHFSGTPFKNYM
SYTDDNCTNSFTPNQVARMHCYLDLVYQQWTQGRKPTPIPMPPVIAGQSENTLAIHWLPP
LSGIVYERESGNLCGDCDEDGTYSQYVHEASSPLICDSSGYWTPKEAIGPPDVSQPCETS
LQAWSPEFNLFNMSMTTPCLQPLGCILELHFLHPVYADSLRIWTTNFSVDSKMLSDIEIL
TEHGDSVHLGPMNTFCDIPLTVKLNLNKKVSGIKLYTFDEKMEIDAAQLISKPHSSLCSS
CRPVRYRVLRDPPFLDGSPAIVTQRGRKFVDKEVIVGQLYQYQVQAVAGATVGEASPPLL
HIHGSPYCGNGKINMALTEECDDGDLLDGDGCSKTCKKEKGFHCVGEPSMCYVHDGDGIC
EPFEKNSSFVDCGLYTPQDYTDQWASEAYASHQDEKACPVSLVTGEPLVRVCSPHPQDIL
ENQPHMAWFPCVSHDVFQDPEREKMLLDDRVWLKVCFNRPSTATSLFVFLASVGASTSDQ
PTSTVTVHLVDTSGHSHFIATYELSCQENPLVINVTENAAFHQITSALLNFSSISVGISA
VALRTHLPLDSSSPSNCLPE
Download sequence
Identical sequences 28377.ENSACAP00000014400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]