SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000014439 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000014439
Domain Number 1 Region: 40-204
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.89e-36
Family Calponin-homology domain, CH-domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000014439
Sequence length 1810
Comment (Anolis carolinensis)
Sequence
MPVLGVASKLRQPPMGSKPVHTAHPIPNLGTSGSQQYSSKSVELPRAESSMLSCQFALKS
ACDFGEVKALQGKTKETEDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLADIIQII
ANEKVEDINGCPRSQSQMVENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLS
RYKQQQHQQQQYYQSLVELQQHVSHSSPPTEIGQPKTQQDMQSSLTARYATQSNHSGIAT
SQKKPSRLPGPSRVPAAGSSTKVQGASNLNRRSQSFNSIDKTKPPQYANGNEKESPKGPH
PSTGMNGNVQHPTSTGQQPVSAIPSPSASKPWRSKSMNVKHSATSTMLSVKQPSPATSPP
PSDRLKPPLSEGPKTPSSGQKSMLEKFKLVNARTVLRPPLSSSSGPSDSVREDEAFLECG
EIDGYSVGLNSGGSTTSSSKISPKLTPPKAGSKNLSNKKSLLQPKDKEEKSRDKNKVCTE
KMVKEEKDQVTETPAKKTSKIASLIPKGNKATSAKKETLIPSSSGIPKPGSKVPAPKQST
SPACSGSKETEKLRSAKGNQPPSTAKCQVNEKVGIPSCLTSEGKESNITLTPCSSNALSM
ASSSGQATGNSTVQLPQQQQYSHPNTATVAPFIYRTHSENDSNSFPPSDFCTSPTKMDLA
YSKTAKQCLEELSGEDPETRRMRTVKNIADLRQNLEETMSSLRGTQISHSTLETTFDSTV
TTEVNGRSIPALTSRSSPVTWRLGQSSPRLQAGDAPSLGAGYPRSGASRFIHTDPSRFMY
TTPLRRAAVSRLGNIPQIDMSEKGTSDLDISSDVDVGGYMSDGDILGKSLRADDINSGYM
TDGGLNLYTRSLNRIPDIAASRDVIQRGVHDVTVDADSWDDSSSVSSGLSDTLDNISTDD
LNTTSSISSYSNITASSKKNTHSHTDSEKRLVTDGESWGSSEELKKPEEDFDSNVDSSGK
WKSHPTGLLEDAEKGGQKNPLSVSQTGSWRRGMTAQVGTSSRHKTGTSTLKTPGKTDDAK
ASEKGKTPLKGTSIQRSPSDAGKSSGDEGKKPPSGISRSTATSSFGFKKAGVSSSTMITA
SGATITSGSATLGKMPKSAAIGGKSNAGRKTSLDGSQNQDDGVLHVSSKTTLQYRSLPRP
SKSSTSGIPGRGGHRSSTSSIDSNASSKSAGATATNKLREPTKIGSGRSSPVTINQTDKE
KEKVAVSDSESASLSNSPKSSPTSANACGTTPGLRQPGSKYPDIASPTFRRLFGAKASSK
TAPAPNTEGPKSTSAMPSPSTTLARQGSLESPSSGTGSMGSTGGQSGSSSPLFSKPSDLN
TDVVSLSHSLASSPASAHSFTSGGLVWAANLSSSSAGSKDTPSYQSMTSLHTSSESIDLP
LSHHGSLSGLTTSTQEVQSLLMRTGSVRSTLSESMQLDRNTLPKKGLRYTPSSRQASQEE
GKEWLRSHSTGGLQDTGSQSPLISPTAMSSSATGKYFSNLVSPTNLSQFKLPGPSMMRSN
SIPAQDSSFDLYDDSQLCGSATSLEDRPRAISHSGSFRDSMEEVHGSSLSLVSSTSSLYS
TAEEKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTMTA
EQKESELIELRETIEMLKAQNSAAQAAIQGALNGPDHTHKDLRIRRQHSSESVSSINSGT
SHSSLGSGNDADSKKKKKKNWLRSSFKQAFGKKKSTKPPSSHSDIEEVTDSSLPSSPKLP
HSYGECPSSSIKPSQSTSAICECTEAEAEIILQLKNELREKELKLTDIRLEALSSAHHLD
QIREAMNRMQ
Download sequence
Identical sequences 28377.ENSACAP00000014439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]