SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000014474 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000014474
Domain Number 1 Region: 521-734
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.28e-105
Family Thrombospondin C-terminal domain 0.00000000183
Further Details:      
 
Domain Number 2 Region: 398-519
Classification Level Classification E-value
Superfamily TSP type-3 repeat 9.94e-37
Family TSP type-3 repeat 0.000000217
Further Details:      
 
Domain Number 3 Region: 317-400
Classification Level Classification E-value
Superfamily TSP type-3 repeat 9.55e-17
Family TSP type-3 repeat 0.0000845
Further Details:      
 
Domain Number 4 Region: 56-114
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.83e-16
Family TSP-1 type 1 repeat 0.0000308
Further Details:      
 
Domain Number 5 Region: 3-52
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000196
Family TSP-1 type 1 repeat 0.0000891
Further Details:      
 
Domain Number 6 Region: 115-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000232
Family EGF-type module 0.018
Further Details:      
 
Domain Number 7 Region: 257-341
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000628
Family TSP type-3 repeat 0.00034
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000014474
Domain Number - Region: 156-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0172
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 218-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-like domain of nidogen-1 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000014474
Sequence length 736
Comment (Anolis carolinensis)
Sequence
RQNGAWSHWSPWSSCSVTCGSGVITRIRLCNSPLPQMGGKECEGEARENVPCEKSPCPIN
GNWGPWSPWDACPVTCGGGVQKRGRLCNNPEPQYGGKDCIGEVSDTQICNKQNCPIDGCL
SNPCFAGTTCTSFPDGSWKCGACPAGYHGNGVKCKDIDECKEVPDACFVLGGVHRCENTE
PGYNCLPCPPRFTGTQPFGRGVDHAIANKQVCKPRNPCTDGTHDCNKHARCIYLGHFSDP
MYRCECKPGYAGNGNICGEDTDLDGWPNENLVCVANATYHCNKDNCPTFPISGQENMRKE
GMGDACDRDDNDEHNDRDNCPFIYNPQQYDYDRDDVGDRCDNCPYNHNPDQIDTDNNGEG
DACAVDIDGDGILNERDNCQYVYNVDQKDTDLDGVGDQCDNCPMEHNPEQTDSDSDRIGD
TCDSNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDKDNCRLVP
NPDQLDSDGDGRGDACKDDFDKDNVLDIDDICPENVDISETDFRRFQMIPLDPKGTSQND
PNWVVRHQGKELVQTVNCDPGLAVGFDEFNAVDFSGTFFINTDRDDDYAGFVFGYQSSSR
FYVVMWKQVTQTYWDIQPTKAQGYSGLSIKVVNSTTGPGTHLRNALWHTGNTAGQVRTLW
HDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFS
QEMVFFSDLKYECRGK
Download sequence
Identical sequences 28377.ENSACAP00000014474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]