SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000014845 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000014845
Domain Number 1 Region: 184-263
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.75e-29
Family GAS2 domain 0.00000483
Further Details:      
 
Domain Number 2 Region: 20-163
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.47e-27
Family Calponin-homology domain, CH-domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000014845
Sequence length 296
Comment (Anolis carolinensis)
Sequence
HSQWLGSDVKLNLVPEGKRNRVLWLTNLLGKEITAEAFMEKLDNGALLCRLAETLQEKFK
ENCIEVNKFGKIMPVRKIPCKANAPSGSFFARDNTANFLSWCRDVGVDDTCLFESEGLVL
HKQPREVCLCLLELGRIAARFGVEPPGLIKLEKEIEQEETLSTPLPSPSPTPSKSPGKKS
TGKILDDAVKYISEDPPCKCPSKFCVERLSQGRYRVGEKILFIRMLHNKHVMVRVGGGWE
TFAGYLLKHDPCRMLQISRVDGKTSPIQNKSPTIKDLNPDSYLVVSAHYKSKKEIK
Download sequence
Identical sequences 28377.ENSACAP00000014845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]