SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000014884 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000014884
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-45
Family Calponin-homology domain, CH-domain 0.0000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000014884
Sequence length 199
Comment (Anolis carolinensis)
Sequence
MANRGPSYGLSREVQEKIEQKYDPELESRLVDWIIIQCGENIEHPPPGRQHFQKWLMDGT
LLCKLINNLHPKGKEPIPKITESKMAFKQMEQISHFLKAAEIYGVRTTDIFQTVDLWEGK
DMAAVQRTLLALGSEAVTRDDGCYKGDPSWFHRKAQRNQRGFSEEQLRQGQNVIGLQMGS
NKGASQSGMTGYGMPRQII
Download sequence
Identical sequences G1KQR0
ENSACAP00000014884 XP_003219186.1.98722 XP_008105972.1.98722 ENSACAP00000014884 28377.ENSACAP00000014884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]