SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000014886 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000014886
Domain Number 1 Region: 186-394
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-51
Family DBL homology domain (DH-domain) 0.0000000842
Further Details:      
 
Domain Number 2 Region: 2-233
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-41
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 
Domain Number 3 Region: 381-543
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-31
Family Pleckstrin-homology domain (PH domain) 0.0072
Further Details:      
 
Domain Number 4 Region: 633-708
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000522
Family SH2 domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000014886
Sequence length 709
Comment (Anolis carolinensis)
Sequence
MDLWKQCANWLIQCRVLPPNHRVTFEGAQVCDLAQALRDGVLLCQLLNNLMPHAVNLREI
NLRPQMSQFLCLKNIRTFISTCYEKFGLRKSDLFEVFDLFDVKDFAKVIDTLSILSWTQI
AQNKGFMPFPTEDSIADDEIYSGLSDQIDDTMDEDDDLYDCVENEEAEGDEIYQDLMRSE
QGVMTVSGQMSELDKRKCCLQEIQQTEEKYTSTLESINQHFLKPLQLFLQPQDLENIFIN
IEELLKVHRCFLADLKSALSFSNAQSLYQVFIRYKERFLLYGRYCSQIEAATKYLDQITN
TSVDVRMKLEECSQRANNGRFSLRDLLMVPMQRVLKYHLLLQELIKYTVEPSDKENLRLA
LDAMRDLAQCINEVKRDNETLKQITNFQLSIENLTQSLAHFGRPKIDGEVKIISGEKRSK
IDRYAFLLDKALLICKRKGDSYEMKQFVDLSNYQVQDDSSVVKDNKKWSHMFLLIELTGS
SGYELYFKTRELKKKWMEQFEMALSNIYPENAMANRHEFHMYSFEDTTSCKACQMLLRGT
FYQGYRCSKCRLPAHKECLGRVSPCGKYGQTKAQGWMKAHLTMYMQDKQETGLPKLEVCQ
EYYGLPPPPVAFGPALKLSVGDIVELSKAEAEQLWWQGRNTSTNEVGWFPCKKVKPYVST
PPPDLSVHLWYAGPMERGEAEQILSTRSDGTYLVRQRIKDATEFAISIK
Download sequence
Identical sequences 28377.ENSACAP00000014886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]