SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000015207 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000015207
Domain Number 1 Region: 99-188
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.28e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000387
Further Details:      
 
Domain Number 2 Region: 189-269
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.45e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.000033
Further Details:      
 
Domain Number 3 Region: 280-367
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.7e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000464
Further Details:      
 
Domain Number 4 Region: 380-452
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.47e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000015207
Sequence length 635
Comment (Anolis carolinensis)
Sequence
MSDYSAAGPPPPSAGPPGAGAGGIRKDAFADAVQRARQIAAKIGGDSATTVNNTTPDFGF
GGQKRQLEDGDQPESKKMAPQPERNLGSNLSADHFPCRSTVTEEYRVPDGMVGLIIGRGG
EQINKIQQDSGCKVQISPDSGGLPERSVSLTGSPESVQKAKMMLDDIVSRGRGGPPSQFH
DNSNGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRI
IGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMI
KKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGSGM
PPGGRGRGRGQGNWGPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPP
NGDPNFKLFIIRGSPQQIDHAKQLIEEKIEGPLCPVGPGPGPGGPPGPAPMGPFNPGPFN
QGPPSAPPHPGGPPPPQYPPQGWGNAYPQWQPPAPHDPSKAAAADPNAAWAAYYSHYYQQ
PPGPVPGAPPAPTAPPVQGEPPQPPPTGQSDYTKAWEEYYKKLAQVATGAGPTAPPGPQP
DYSAAWAEYYRQQAAYYGQTPGAGGPVPPPTQQGQ
Download sequence
Identical sequences 28377.ENSACAP00000015207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]