SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000015553 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000015553
Domain Number 1 Region: 21-137,182-292
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-30
Family Calponin-homology domain, CH-domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000015553
Sequence length 294
Comment (Anolis carolinensis)
Sequence
GEKRKYINPSSRNDPKLEALHTVLLEWINTTLQHEHIVVRSLEQDLYDGLVLHHLLEKLG
SLTLKAEKLALTEMKQRLKLATILETVSTCLKLEESELKWSVDAILKKDLLSTLHLLVAL
AEHFKPSLALPPNVKVDIIITERTSNGLKTENGVEFITKDREDRNLFEAEIFDDLLKNAP
EKLDAVKEVLLKFVNKHVEKLGLTVKDINAQFADGVILILLIGQLQGYFLNLGEFFLNPT
SVSEKMHNVNLAVELLMDEGLLDTPINLEDVVNQDTNATLLLLYCLFSKFKTKE
Download sequence
Identical sequences 28377.ENSACAP00000015553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]