SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000016577 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000016577
Domain Number 1 Region: 31-217
Classification Level Classification E-value
Superfamily vWA-like 3.71e-55
Family Integrin A (or I) domain 0.00027
Further Details:      
 
Domain Number 2 Region: 229-421
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.42e-26
Family Laminin G-like module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000016577
Sequence length 956
Comment (Anolis carolinensis)
Sequence
MAKNVTFLSTVLMLLLHDYVSSEDGDIRSSCRTAPTDLVFILDGSWSVGPENFEIVKRWL
VNITSNFNIGPKFIQVGVVQYSDYPVLEIPLGFHDSNENLVRGMEYIQYLGGNTQTGKAI
QFALDHLFAKSSRFLTKIAVVLTDGKSQDDVKEVAAEARKNRITLFAIGVGSETEEDELR
AIANKPSSTYVFYVEDYIAISRIREVIKQKLCEESVCPTRIPVASRDEKGFDILLGLGVK
KKVKKRIQIPFTNAKAYEVTSRIDLSELTRNVFPEGLPPSYVFVSTQRFKVRKTWDLWRI
LSLDGRPQIAVTIHGEDKTLSFTTTSLVNDTQVVTFTAPRVKILFDEGWHQIRLLVTEAD
VTLYIDDQEIEVKPLHPVLGIYISGVTQIGKYLGKEENVQFDVQKVRIYCDPEQNNRETA
CEIPGFVKNCMNGPSDVGSTPPPCICPPGKQGPPGSKGDPGLPGNHGYPGEPGPDGKPGY
QGIAGTPGIPGSPGIQGPRGLPGMKGEPGLDGAKGERGLPGFPGLHGMPASKGDRGSKGD
PGPPGIYGKKATKGGKGDGGFPGMPGRPGDPGRTGKDGLPGIPGLKGEDGQPGSTGPEGR
RGDPGIPGIPGMQGIKGEKGEIGPPGQEGTNGSPGTPGLPGPEGSLGLPGGPGPKGSKGE
QGLQGKPGPSGVKGEYGQPGTPGEPGYPGIPGTPGLKGDKGNSGERGFQGKKGESGRLGN
PAKYNIHSYQLTIHEKGEKGDPGIHGINGQKGEPGMGGLVGPPGPRGGQGERGSPGIPGS
DGKPGRGFSEEFIRQVCADVLRTQLPTMLQNGRLHCDQCQSHGMALGPPGPPGPVGPQGP
RGFPGLQGNDGLPGLTGAPGRHGSRGAKGLPGRNGAKGSQGIGLPGIPGPPGPPGPEGPP
GMSKEGRPGESGEPGKDGERGSPGMPGRTGPPGICDPSLCFSVIVGRDPFRKGPNY
Download sequence
Identical sequences 28377.ENSACAP00000016577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]