SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000016680 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  28377.ENSACAP00000016680
Domain Number - Region: 35-101
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000261
Family Canonical RBD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000016680
Sequence length 149
Comment (Anolis carolinensis)
Sequence
METATTLEVIEECAVPVNSFDKYFEKALEDSKAEVKEEDCSAQSSVLYIGNLNPKYSREV
LCSMLKDILGMAGVTLQRHHIEVVKKRKQAYAFIQVAKESDSAGSCSEYPLGGPQVPEKS
RKGLSNETRINAIRKSTPYPWKLVDRPMK
Download sequence
Identical sequences 28377.ENSACAP00000016680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]