SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000016939 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000016939
Domain Number 1 Region: 1090-1229
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.57e-60
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000259
Further Details:      
 
Domain Number 2 Region: 235-329
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0001
Family Calponin-homology domain, CH-domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000016939
Sequence length 1234
Comment (Anolis carolinensis)
Sequence
MVAAAPAAAAAMRKGFLVPEIKPLDQYDFARARSAAGLAWVLAKGYGGAEHVPAELREPF
YTDQYEQEHMKPPLIRLLLSSDIYCRAWRQALPPGPDGNPSPKDNAALLQLLTRRGLVPT
FQDKPVKEADLHHKPIRLGAHLALIDSLMTAYAVEATSSLSVAPAAISWDQKLLHWIDLI
IHKIQQHVEQECSQRSAPGTDGQNQACSSGPKIRYRKDKALPKQTPCFPAIAGMKDLSSG
GAVAATIHYYCPQVIRLEDVCLKETMSVADSLYNLQLIQGFSSDYLGGACFLSLEDLLYM
PPALRINVGVFLAELFLCFEVLKPDFVRPKELPGLQACAPLTTELPSSCISSPVFNFRHP
LLPGGQAQSPLCGSLGSLHHSTSMSHVEGFGKAWTKKQLSHPLSQAVSFSIPFGLDSDVD
IVMGNPVGILRSVSSDSLAPALYSSLPQGLPLENGLTDGYSDLPTIEEALQIIHSSERLL
PEGAPDGFYLHSPEPPKASAPEKVPMSTVYRCHNGPPNGGELTQDGSLDSDAEEVSRPPG
APDDSTSCPDSTASSASGVRMTSFAERKKKLAATDSKSRPVPPDESPAQSPALSSEMSQL
GARLEEKRRAIEAQKKRIEAIFTRHRQRLGKSAFLQLQKAPDSQTQSEDSRLTLEERLAQ
LEAEDEAGSPRTRLENKQVTFSPEIMKGGLDENLGDYNRAVAKLNTALSSLQMDMQRLSE
QQQRLMQDKKPSAQAWVIPAPRPSREGAPTRSSPTPKKSPAPAPPKSPKHTRPVELKLPP
LTRVLTPPHNVDTLPHLRKFSPSQVNVQTRSSIHFAEDEELPIPEAEAQNNLRPVASVPP
QGGEEDDDVDGDDSLEESIAETLDSEPRSGLGFFFKDEEKAEDEMAQKRATFLERQQRRT
DEARRRKQWQEEEKEQKKEEASKMAQRLFCYVVTLSTSSYTKILALDGTCLSRPRQEEEV
GTRRGDFTRQEYLRRHQLKLMEDLDKVLRQKPTTVRALKKGRPKTVFCDDSALARSPVKG
LLGSKLSKVYSQSTLSLSTVANDPGNSLSIKRSSRAASPSGPMSPSRLISNQSRERDWEN
ASTASSPASIPEYTGPKLYKEPSAKSNKYIIHNALSHCCLAGKVNEPQKNRILEEVEKSK
ANHFLILFRDSSCQFRALYTLSGETDELTRLAGYGPRTITLPMIEGIYKYSSDRKRFTQI
PSKTMSMSVDAFTIQGHLWQTKKPGTPKKPGTPK
Download sequence
Identical sequences 28377.ENSACAP00000016939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]