SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000017911 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000017911
Domain Number 1 Region: 287-441
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-42
Family SPRY domain 0.00013
Further Details:      
 
Domain Number 2 Region: 4-81
Classification Level Classification E-value
Superfamily RING/U-box 1.91e-21
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 104-144
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000534
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000017911
Sequence length 441
Comment (Anolis carolinensis)
Sequence
MAATNYATALQEELFCPICLDYFTDPVILNCEHNFCRACISTYWESLGDSFPCPQCRKRC
RNGKVRPNAQLGKVAERAKELAARDTALPRMPPVAGNKPEPVQEMCKQHLETLKLFCKDD
KSLICVVCDKSKEHRNHTFQHHLATLKSERDSREILAINNGKKLEMLVVSVFTSLKQNAF
VFWELKKTLKDREDSLLQGLSKVRNDLKQMQRENERKIQQGTPLLQGLILELQQKCQQSD
TEFLKVKLDRQEGGVCRLEQLPPCFHLVIKLKLSHGSRPSLKENSKILTLDPDSAHPSLV
ISANRRTASCRDICPTHGNTSKRFYPSFCVLGSEGFAGGRHHWLVDVKGQCGWALGVAKE
SVDRKKPVVLQPERGIWAVELGPCQLFPTTPASKEETETSTRRILVSLDYERGRLTFSDS
QDTKPLFTFRTSFTEKLYPFF
Download sequence
Identical sequences 28377.ENSACAP00000017911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]