SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000017935 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000017935
Domain Number 1 Region: 2-46
Classification Level Classification E-value
Superfamily Kringle-like 6.57e-17
Family Fibronectin type II module 0.0021
Further Details:      
 
Domain Number 2 Region: 49-94
Classification Level Classification E-value
Superfamily Kringle-like 1.48e-16
Family Fibronectin type II module 0.0031
Further Details:      
 
Domain Number 3 Region: 96-150
Classification Level Classification E-value
Superfamily Kringle-like 2e-16
Family Fibronectin type II module 0.0012
Further Details:      
 
Domain Number 4 Region: 157-202
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000857
Family Fibronectin type II module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000017935
Sequence length 202
Comment (Anolis carolinensis)
Sequence
KACVFPFIYKNQTFYTCTNENSADGRFWCATTSNYDTDKMWSYCADTISRPCVFPFIFQG
KLYSTCTTNGTRKNQPWCSITSNYDRHRRWKPCTLTEYGGNSGGKPCFFPFLYQRRTYYT
CTRKYSRGRFWCSTTGNYDINRKWSYCADNRLEESYPTEPCYFPFMYKNKLYTSCTTAGR
TDGKLWCSVNRNYDMRPSAVFC
Download sequence
Identical sequences 28377.ENSACAP00000017935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]