SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000017954 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000017954
Domain Number 1 Region: 14-169
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-29
Family Laminin G-like module 0.0065
Further Details:      
 
Domain Number 2 Region: 190-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000524
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000017954
Sequence length 246
Comment (Anolis carolinensis)
Sequence
LKVSLLLGSLFSLCFGLEFMGLPNQWARYFRWDASTRSDLSFQLKTNVSAGLLLYFDDGG
VCDFLCLSLVDGRIQLRFSVDCAEATVVTDKQVNDSNLHFLMVSRNHLRTVLVLDGEAKP
GEVRPQRQYMNIVSDLFVGGVPSDIRPAALTLDSVLSEPPFKGFILDLKYGTSEPQLLGH
QGVRLDMEGLCTENPCENGGTCFLLDGEPQCDCSDTGYVGKRCSEVLGESKRTILIKSMN
NQKHKC
Download sequence
Identical sequences 28377.ENSACAP00000017954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]