SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 283942.IL1448 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  283942.IL1448
Domain Number 1 Region: 45-116
Classification Level Classification E-value
Superfamily HCP-like 0.0000000615
Family HCP-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 283942.IL1448
Sequence length 156
Comment (Idiomarina loihiensis L2TR)
Sequence
MTQANVNEWQTALLTQVDQLIELAQTRLPGRQKPTIRGPEYWQRFAKHHYVRAADLLKTG
QGFEAAKHFRRAALFGHSKAMLYLGQMFLQGKDLPESIFHACCWLTLADRAGESEAAKII
DGFLHQLTARQLNSARQLAAERFEQICDASFDVHGL
Download sequence
Identical sequences A0A2D4R9B9 Q5QY33
WP_011234694.1.4909 WP_011234694.1.75220 WP_011234694.1.75540 283942.IL1448 gi|56460556|ref|YP_155837.1| gi|507385873|ref|YP_008034952.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]