SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 283942.IL1726 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  283942.IL1726
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ribosomal protein S16 2.35e-29
Family Ribosomal protein S16 0.0000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 283942.IL1726
Sequence length 82
Comment (Idiomarina loihiensis L2TR)
Sequence
MVTIRLQRGGAKKRPFYQMVVADSRNARDGRFIEKVGFFNPVARGQEEKLRVDVDRIEHW
VSKGAQLSDRVAKLVKDASAAA
Download sequence
Identical sequences A0A0N0IM10 A0A2D4RCA0 Q5QUU8
WP_011234962.1.12778 WP_011234962.1.4909 WP_011234962.1.57852 WP_011234962.1.75220 WP_011234962.1.75540 gi|507386155|ref|YP_008035234.1| gi|56460827|ref|YP_156108.1| 283942.IL1726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]