SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2850.JGI1559 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI1559
Domain Number 1 Region: 99-200
Classification Level Classification E-value
Superfamily Subtilisin-like 1.57e-16
Family Subtilases 0.00073
Further Details:      
 
Domain Number 2 Region: 41-113
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0000000102
Family Subtilase propeptides/inhibitors 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI1559
Sequence length 216
Comment (Phaeodactylum tricornutum)
Sequence
MIHASCLSFALLVAANFIGVAFAQQLSEHRKLSRIVGGQAIPGQYIVQLDKRIPDSKGFA
TKVLKRALKSKVINTYDYAFKGFAVANLPDTVLSVLLNLNEVRDISEDGVVTIDAIQSKP
VWGLDHIDGVDDDMYEYAYTGLGVDAYIIDTGILASHADLEGRVASCISFTGEACGFDLH
GHGTHVAGTVGSKTYGVAKQSLTSMELDHMPTSLLQ
Download sequence
Identical sequences B7S3L3
2850.JGI1559 jgi|Phatr2_bd|1559|estExt_fgenesh1_pg.C_bd_8x170009 XP_002176150.1.39622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]