SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2850.JGI17276 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI17276
Domain Number 1 Region: 92-166
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.58e-27
Family Skp1 dimerisation domain-like 0.0000466
Further Details:      
 
Domain Number 2 Region: 9-74
Classification Level Classification E-value
Superfamily POZ domain 2e-16
Family BTB/POZ domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI17276
Sequence length 169
Comment (Phaeodactylum tricornutum)
Sequence
MMDVEQETTVNLISKDGDSFSVPLAVAKMSELVKGMIDEDAEDEGDKIEIPLPNVKSQVL
NKVIEFCEHHLQEPMTEIEKPLKSQVMADVVQKWYADFVDVEQVLLFELILAANYMDIKP
LLDLTCATVAGMIKGKTPEDIRQTFGIQNDFSPEEEAQVREENKWCEEA
Download sequence
Identical sequences B7FNR9
jgi|Phatr2|17276|estExt_gwp_gw1.C_chr_10153 XP_002176583.1.39622 2850.JGI17276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]