SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2850.JGI20608 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI20608
Domain Number 1 Region: 372-543
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.15e-46
Family Ribonuclease PH domain 1-like 0.0000228
Further Details:      
 
Domain Number 2 Region: 89-218
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.67e-35
Family Ribonuclease PH domain 1-like 0.0000542
Further Details:      
 
Domain Number 3 Region: 525-628
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.79e-22
Family Ribonuclease PH domain 2-like 0.00017
Further Details:      
 
Domain Number 4 Region: 212-305
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.21e-21
Family Ribonuclease PH domain 2-like 0.003
Further Details:      
 
Domain Number 5 Region: 701-786
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000304
Family Cold shock DNA-binding domain-like 0.0035
Further Details:      
 
Domain Number 6 Region: 636-722
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000025
Family Eukaryotic type KH-domain (KH-domain type I) 0.005
Further Details:      
 
Domain Number 7 Region: 302-400
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000798
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI20608
Sequence length 830
Comment (Phaeodactylum tricornutum)
Sequence
MAFNMKFLALFLTFFQGEECWAFHPIASFRSGRSGRKGVDGSASTSSRWASDGSGTAFSI
ESDHSGPAGFPVHRVIFHSLPGQEQDVPPICIETGKIGRQAAGAVTLTRGDSVLYATTSH
DKDPKEEIDFCPLSVDYQERFSSAGLTSGGYNKRDGRPAEHEILTCRLIDRPLRPLIQSG
WRHETQLLSWVLSYDGERSCDPLAIIASASSLFISDVPLHKPVAAVQVGMKDDGTLVVNP
TNLQMETSKLNLMVAGTEEAVLMIEGAADFLPESTMIQAVKTGHEAIQVLCQGLTALGKV
AGKEKKLDTIKATPENLQIRVDELFSDRIDDMWSSGLGKEAQGKIMTDLYTAVVGELIED
YPGETVAIKGAFKDLLCRRMFFRAREEGLRCDGRGPTDIRQLTMETGLLPRVHGSALFTR
GETQCVATTTLGGSGMRQKIEKLDGTDEKRFYLQYTFPPSCVGETGRVGAPGRREVGHGN
LAERALIPTIPALADFPYTIRVESLITESHGSSSMASVCGGSLALMDAGVPIKAPVAGIA
MGMLLGDKGGVSDENAVILSDILGTEDALGTMDFKVAGDRVGISTFQLDIKCEGLTLETM
ESALEQARTGRLHLLSEMEKVIASPREELPATVPKMMSFSIPVEAIGKIIGPGGKQIRAI
IEDFELVNMDVGEEGGVQLSSFDTAKMGEAQTFITTLVRPEPVEGETYTGKITGIHPFGV
FLEILPGAEDGSYPGLEGLVHVSELAHERVRNCEGFMKSMNVEELTVKYLGKDKGKLQLS
RKALLEEQGGDGGRRNGSRGPSREAAAPTPEMTKDEIDVIAQAIEGVTEL
Download sequence
Identical sequences B7G0I4
2850.JGI20608 XP_002180684.1.39622 jgi|Phatr2|20608|estExt_gwp_gw1.C_chr_90272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]