SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2850.JGI41172 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI41172
Domain Number 1 Region: 15-225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-58
Family Calnexin/calreticulin 0.000059
Further Details:      
 
Domain Number 2 Region: 208-315
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 5.62e-41
Family P-domain of calnexin/calreticulin 0.00000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI41172
Sequence length 390
Comment (Phaeodactylum tricornutum)
Sequence
MKFTLLTVLAAAVAVPVTAEVYLKEQFNDEAWTSRWTESKDWKPESDMGTWKHTAGEWYS
DEADKGIQTSVDARFFGISAPLDKPYTSSKDKDLVIQYSVKHEQDLDCGGAYIKLLPGGK
SFQPAAFGGESPYAVMFGPDICGSSNKKTHVILHSNQKDENLLINKQVMCESDSVTHLYT
LVVRPDNTFEVFVDNKSVRSGNLADEFDFLEPKEIKDPDAQKPEDWVDKAKIADPEDKKP
EGYDDIPQELPDPDAVKPDDWDDEDDGEWEAPMIDNPEYKGPWKPKMIENPDYKGPWVHP
MVPNPDYKDDDEMFMVCKDTCTHVGFELWQVKTGTLFDDIIVTDSLEEAHAFAQETFFKK
KDGEKEMYDKIQAERQPEMPDMVSGETLSY
Download sequence
Identical sequences B7GDH4
2850.JGI41172 XP_002185131.1.39622 jgi|Phatr2|41172|fgenesh1_pg.C_chr_28000057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]