SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2850.JGI44729 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI44729
Domain Number 1 Region: 251-326
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00057
Further Details:      
 
Domain Number 2 Region: 436-513
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.62e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 3 Region: 359-431
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000292
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Weak hits

Sequence:  2850.JGI44729
Domain Number - Region: 133-189
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0104
Family Eukaryotic type KH-domain (KH-domain type I) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI44729
Sequence length 699
Comment (Phaeodactylum tricornutum)
Sequence
MDVTQSQLADEAIQRAKAIAARLTGQPVPVTHDGTADANSTTSSTGKRKRWGLTPDDTDD
DPNNNNNNNNNNNNNNNNNNNNNNSTQKLSAVQVELVSKRFWIATSEAKPPSHFLSYLTP
RFEDCVESLRNNNINKASALSIVFHGRGSSSQPPPPGMPQEPLHVIVQGTAALVAQAQDK
VHQLLLDAEEAPLEGVVTDADNTQALTTIAANRDNDTHSHALSSYRPASVAQMIGQANLP
PETHGGPMLDDEILVPTGVVGFIIGRGGENITAMQAQTGVKVQIQKEHELVPGQTTRTIL
LQGATQESIDACKRIIEAKVQERVRSYNANQSSLQGATGLGGSGKDPKVEMALAAGHQLV
EVQVPDADVGLIIGKMGATIKHIQATTGAAVQVPHAVPGEATRLLQITHPSREGAEQAKR
MVQELLDSKIHHQQNEAPSQTSVEVNIPDRDVGLCIGRQGCVIRHMQSVTNTRIQIPSQP
MPGHTYRVATVTGTPEGCAEAKAMMERISHEQSSAGVLSGAPPSNGYGSQSAYYGQQQQQ
QQSHDANGVYSAEWAAYHAAQAAVAAAAAAQQPTVQSAPAAAVYSTPAAAPTTTTSATAS
QPAADAYYEQYFRYAYYYGDDAARQYYGAWSPPPGTPNPYGVNPNGITAAPAAAPVAAST
STTPAPTPASTVPDATDSAVRDTGRRKVSNLPAWMTNQN
Download sequence
Identical sequences B7FVF4
XP_002178921.1.39622 jgi|Phatr2|44729|estExt_fgenesh1_pg.C_chr_50023 2850.JGI44729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]