SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2850.JGI45441 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI45441
Domain Number 1 Region: 137-242
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.13e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI45441
Sequence length 379
Comment (Phaeodactylum tricornutum)
Sequence
MADISKSTTDATKKNHNKYRRDKPWDNDDIDHWKLASWNADDGGDTLPGGRLLEESSFAT
LFPKYREAYLRQIWPVVTRHLDQHGVACELNLVEGSMTVRTTKRTKDPYVILKARDLLKL
LARSLPVAQAVKILQDDYQCDIVKIGGLVRNKERFVKRRQRLLGPDGSTLKALELLTGCY
ILVQGNTVSIMGDSWKGLKQARRVVLDCLKNIHPVYHLKRLMIQKELAKDPALQNEDWSR
FLPQFQKKNVQTKKPSVRKTKKSYTPFPPAQQPSKIDLQLESGEYFATEFERKTKKVADR
KEASKSKSIAKRKARELEEETPVLASRKAKTTTTKEDIPVEQRIKDKFQKAAQASQSSTS
DPADFIQGSGSGSKRGKKS
Download sequence
Identical sequences B7FXP7
2850.JGI45441 jgi|Phatr2|45441|estExt_fgenesh1_pg.C_chr_70067 XP_002179593.1.39622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]