SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2850.JGI50292 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI50292
Domain Number 1 Region: 287-390
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000677
Family Galectin (animal S-lectin) 0.0038
Further Details:      
 
Domain Number 2 Region: 445-515
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000353
Family Canonical RBD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI50292
Sequence length 550
Comment (Phaeodactylum tricornutum)
Sequence
MASTNSDTAPIGSSANGSSTNPNPQDAVSSQWKTPSAAYQQMYGVCGVPDDVTPTAEEEL
VLRFYDTIRAYERQAARLQDDAARAKLASRDAAFQAASVSRNPRKRRERTRITTTTTTTE
DSDDPHSADENDEDDDAASDDAEARHARREAKLEELRDQVAQAHQLAQERTRVDEPPPTT
WQTANVDDAVDVGSQPVLKKKKRIESDPSEPTSSLIANITVAQTPPHDFSKTLALVPGRT
LWPTTISTTEPAAWTPPAGCTQPNEGAFAVHLDNFDILQAQNGSGNNTVAVKFTAPSDSK
RFSINIAAPDHEEFHSVLFHFNPRQHERGGQLIVNDKQEGIWGQAIAIPLSQVPLVFGQT
ACTLLIQVNGEGFDIFLEGQHCARLEHRKEIATDTDHLVLQFPSTDDYGSPENWLVHKVW
WGNQPILAKGDLANVAGVHTYNALHPRKLFVSRLAKIFSEAEVDLRRAELERAFRQYGGV
HGVSVIVPTNATFAFVETESERAADLALQEMTAQYRVSRARRSRHEALQEERAAAEASAR
GETKEHTVWD
Download sequence
Identical sequences B7GDL2
XP_002185233.1.39622 jgi|Phatr2|50292|estExt_fgenesh1_pg.C_chr_280094 2850.JGI50292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]