SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2850.JGI51303 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI51303
Domain Number 1 Region: 18-124
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.84e-28
Family Canonical RBD 0.0029
Further Details:      
 
Domain Number 2 Region: 106-217
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.75e-24
Family Canonical RBD 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI51303
Sequence length 222
Comment (Phaeodactylum tricornutum)
Sequence
MRLFLTQYTFSRICSFFNRRVYVGNLSWSVAWQSLKDHMRQAGEVVHAEVIMEYNGRSKG
CGIVEYATDEEAQEAIKTLTDTELNGRMIFVREDRETPNQGASYQGESRGWIGSWRGRGR
GGRGISSYGGGRGIGRLNVDAETQLFVGNLAQSTTWRELKDHFRQCGDIQRAEVKNGPAG
QSKGFGTVQFLKKSDAKDAITQLNGSELQGNVIEVRLDQKAR
Download sequence
Identical sequences B7GER2
XP_002185593.1.39622 2850.JGI51303 jgi|Phatr2|51303|estExt_fgenesh1_pm.C_chr_330001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]