SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2850.JGI54066 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI54066
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily SNARE-like 4.12e-21
Family Synatpobrevin N-terminal domain 0.00064
Further Details:      
 
Domain Number 2 Region: 137-203
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000000068
Family SNARE fusion complex 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI54066
Sequence length 227
Comment (Phaeodactylum tricornutum)
Sequence
MPPILTQVARSSDALPLIATSTPTHNLSVSQKQQQDAKQLMRSMTAGNPNKMSIQSERMV
FYYMQRDNLCFLTLTEDSYPKRLAFLYLEEVADAVLQELVREFGTDWRANVDQAARPFQF
IHYDPIIQRKQREFRDQRDVKNKSKLQEDLGEIQSIMKKNIDEILNRGEKLDNVSNISNE
LRSKSKDFKWGTKKLTWQARMQQYGPMVVGASIICIVLYVKIFHIGF
Download sequence
Identical sequences B7FR63
jgi|Phatr2|54066|estExt_Phatr1_ua_kg.C_chr_10159 2850.JGI54066 XP_002177527.1.39622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]