SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2850.JGI54681 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI54681
Domain Number 1 Region: 22-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-64
Family Glycosyl hydrolases family 16 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI54681
Sequence length 1028
Comment (Phaeodactylum tricornutum)
Sequence
MSIRLFSTALLAACLAKATAQTCPTLIWSDEFDGSNLNADNWTPQIGDGCDISVDLCGWG
NNEAQFYRSQNIAVADGSLKINALRQTFGEKEFTSARIRSFEKFDIDLTQPYVRIEARIK
VPLGQGLWGAFWMMPSPEVLWPKGGEIDIMEFIGREPNSAYGVIHYGNLFRDKSELGGPL
KMPTSPSENFHIYTIEKTPNRIAWLVDGFEYQSYTNSDIQPKYSWPFEQTYHLILNLAVG
GNWPGYPDRDQAVDVIMEVDYVRVYDMSGGSIGSITGESLVQINGADGLYCIDDSDVLFT
DIAWTVPTGSSFTPSLDDGNCIIVAFGSVSGYIQAVGQTADCGPLSYSMPVEVQPLYQKE
FAVVPIEEGSTTIGASTGSQSFLLIDGIPTFQYDRLASDLYDNIIIGTSDVSDASLYVSE
QKKFYMDISSPTAATCTRVIIQFEDTTTALPDNYPIGRHSRYVGYLDDSESFQRVEFTYY
DRPDTSVADNAVSQLAVLIDPFLFRGDRYLIRNFDSSSAGCSSNCEPLSTNACRTYAKSE
QGMCTDGENNDREGYNGDDQIDCEDADCYGLDPACPLREGRATEVPTMLSPTLAPTGLPT
GNASDPPSIVPSSETAFPTATGTVRVTSRSSDIPSSKPNIMPITSGPTSSAAPSYSNDEA
ECDAQPRCAALDLAGVCCPTIDAVYLDCCDNRPIDPNSEAGFCNDGIDNDNDGLFDCEDP
DCANDEMCRADCVAIGTCAGLSGQCCPTIDSIFLDCCDAAVLSAGYSVDFSLIDPATIEE
QAAYWLSTSPYTVPGVAPDGSTPVVDYARDEATLYDMIYYQTGSIEKASEYVIGRRKIYM
DVWTDAPECTQIILQFDSLPTAVADNYPTGRHSRYVAFTTRRNEWERIALDFWDRPDGDL
DDTVINTIALFFDPGTLTSHQFYFRNMDSTLSGCRENCEVAAIDDYCLALSSGESGFCGD
SLDQDGDGLIDCVDPDCTLDEACSAQLSISYSALQDNSFRTAASSSSAQVILNGGLIVSF
LAILHTIA
Download sequence
Identical sequences B7G259
XP_002181321.1.39622 jgi|Phatr2|54681|estExt_Phatr1_ua_kg.C_chr_120010 2850.JGI54681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]