SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2850.JGI8469 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI8469
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.09e-30
Family Chaperone J-domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI8469
Sequence length 61
Comment (Phaeodactylum tricornutum)
Sequence
YETLGVRKTCSESELKKAYRKQCLKYHPDKGGDEDKFKEIQKAYETLSDPEKRQIYDKFG
D
Download sequence
Identical sequences B7FYR1
jgi|Phatr2|8469|gw1.8.298.1 2850.JGI8469 XP_002180217.1.39622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]