SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2850.JGI8815 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI8815
Domain Number 1 Region: 81-152
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.96e-18
Family Skp1 dimerisation domain-like 0.00028
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily POZ domain 0.00000000212
Family BTB/POZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI8815
Sequence length 158
Comment (Phaeodactylum tricornutum)
Sequence
SKEGDAYEVPMAVAKMSVLVADTFDADEDDDEAEPVKDFPLPNVTSGVLEKVIEFCKHFQ
EEPMTTIQTPLKSSKLEDLVQQWYADFVKVPKTLLFDLVAAANYMDIKPLLDLTCLAVSI
LIKGKSAAELRSMFNLSDELSHEEEAQMAQGNQQFADR
Download sequence
Identical sequences B7FQ94
2850.JGI8815 XP_002176839.1.39622 jgi|Phatr2|8815|e_gw1.1.859.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]