SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 288000.BBta_0062 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  288000.BBta_0062
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.38e-51
Family Ribonuclease PH domain 1-like 0.0000186
Further Details:      
 
Domain Number 2 Region: 294-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.47e-48
Family Ribonuclease PH domain 1-like 0.0000104
Further Details:      
 
Domain Number 3 Region: 145-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.57e-29
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 4 Region: 451-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.58e-27
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 555-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.39e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 
Domain Number 6 Region: 621-703
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.95e-22
Family Cold shock DNA-binding domain-like 0.00045
Further Details:      
 
Domain Number 7 Region: 238-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 9.42e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 288000.BBta_0062
Sequence length 720
Comment (Bradyrhizobium BTAi1)
Sequence
MFTKHSVEIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKSPREGVDFLPLT
VDYQEKAYAAGRIPGGYFKREGRPTEKETLVSRLIDRPIRPLFVDAWRNETQVIVTTLSH
DMENDPDILAMVAASAALTLSGVPFKGPIGAARVGFANDEYILNPTLDEMTDTQLDLVVA
GTSDAVLMVESEAKELNEDIMLGAVMFGHRHFQPVINAIIELAEKAAKEPRDVAIIDNSA
IEKEMLGIAEQDLRKAYAIPVKQERYAAVAAVKEKVMAYFFPEGQEPKYEKLRVADVFKE
LEAKIVRWNILDTGRRIDGRDVKTVRNIVCEVGVLPRAHGSALFTRGETQALVVTTLGTG
EDEQYIDALSGTYKETFLLHYNFPPYSVGETGRLGGTKRREIGHGKLAWRAIHPVLPPHH
EFPYTTRVVSEVTESNGSSSMATVCGSSLALMDAGVPLKRPTAGIAMGLILEGSRYAVLS
DILGDEDHLGDMDFKVAGTESGITSLQMDIKIEGITEEIMRVALGQAREGRIHILGEMSK
ALTAARAELGEYAPRIETFKIPTDKIREVIGTGGKVIREIVEKTGAKVNIEDDGTVKVAS
SDGEAMKAAIKWIKSIASDPEIGQIYDGTVVKVMEFGAFVNFFGTRDGLVHISQLADKRV
QKTTDVVKEGDKVKVKLLGFDDRGKTRLSMKAVDQTTGEDLEAKQKAEGGAEAPREAAGE
Download sequence
Identical sequences A5E870
WP_011942587.1.57540 gi|148251685|ref|YP_001236270.1| 288000.BBta_0062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]