SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 288000.BBta_0417 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  288000.BBta_0417
Domain Number 1 Region: 37-142
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.11e-38
Family Iojap/YbeB-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 288000.BBta_0417
Sequence length 148
Comment (Bradyrhizobium BTAi1)
Sequence
MSQSALPKTKATTSKSATAKARKTPTHDAALQAQPDADKTLRTILSRLEDMKAEETVTID
LHGKSAYSDYMVITTGRSNRHVGSIAENVAKGLKEAGAKKVHIEGLPNCDWVLIDSGDVI
VHVFRPEVREFYNLERLWTQGPNPAKTL
Download sequence
Identical sequences A5E959
288000.BBta_0417 gi|148252024|ref|YP_001236609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]