SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 288000.BBta_5087 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  288000.BBta_5087
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 9.81e-30
Family Ribosomal L11/L12e N-terminal domain 0.0000423
Further Details:      
 
Domain Number 2 Region: 68-140
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 7.33e-26
Family Ribosomal protein L11, C-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 288000.BBta_5087
Sequence length 142
Comment (Bradyrhizobium BTAi1)
Sequence
MAKKVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQKEEKNTPIPVVIT
IYADRSFTFEMKTPPMSYFLKQAAKIQSGSKAPGRDKAGKVTKAQVREIAEKKMKDLNCD
SIESAMKMVEGSARSMGLEVAG
Download sequence
Identical sequences A5ELP2
gi|148256407|ref|YP_001240992.1| WP_012045056.1.57540 288000.BBta_5087 2005391767 2005348641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]