SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 288000.BBta_6298 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  288000.BBta_6298
Domain Number 1 Region: 22-132
Classification Level Classification E-value
Superfamily Globin-like 1.7e-27
Family Truncated hemoglobin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 288000.BBta_6298
Sequence length 144
Comment (Bradyrhizobium BTAi1)
Sequence
MNSPAAQTDRHPLAVQHPELDDASIRLLVETFYGRAREDALIGPIFNRAVADWDEHIDRI
SDFWSSMFLKTGRYNGAPMRPHLALSLQGAHFDRWLQLFEATARELFAPDLADLFIIRAR
RIADSFEMGIASTRGELMRPRHSV
Download sequence
Identical sequences A5EPX2
gi|148257537|ref|YP_001242122.1| WP_012046164.1.57540 2005396249 288000.BBta_6298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]