SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 288681.BCZK2723 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  288681.BCZK2723
Domain Number - Region: 60-100,156-207
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00262
Family Calcium ATPase, transmembrane domain M 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 288681.BCZK2723
Sequence length 227
Comment (Bacillus cereus ZK)
Sequence
MNGLIFTTMISFGLPLIALLYAFWKKRYIPYMLGVLAFVVSQILIRIPILNYLNGTSTDF
QMFSVMQPILFAVLLSISAGIFEEIARFIAMRYFMKQRDWQSGFLFGAGHGGIEAVLIVG
IPVISLLLSQTVIQNGDSYYLGGIERIFAMVLHVGLSFIVLQAVVQKKFRYVVYAILIHG
TVNALAGIISLYVPGKSGIIMSEVSIAIFALLTFSYSFILKRKGVLK
Download sequence
Identical sequences Q639V7
288681.BCZK2723 WP_001013701.1.29451 WP_001013701.1.30336 gi|52142519|ref|YP_084310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]