SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 288681.BCZK4570 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  288681.BCZK4570
Domain Number 1 Region: 6-297
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.44e-74
Family Diacylglycerol kinase-like 0.0000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 288681.BCZK4570
Sequence length 300
Comment (Bacillus cereus ZK)
Sequence
MTKTKFEKVLLIVNPKAGQGDLHTNLTKIVPPLAAAFPDLHILHTKKQGDATKYCQEFAS
KVDLIIVFGGDGTVFECTNGLAPLETRPTLAIIPGGTCNDFSRTLGVPQNIAEAAKLITK
EHVKPVDVAKANGQHFLNFWGIGLVSEVSNNIDAEEKAKLGKIGYYLSTIRTVKNAETFP
VKITYDGQVYEDEAVLVMVGNGEYLGGIPSFIPNVKCDDGTLDIFVVKSTGIQAFKDYIG
KKLFEDSNENDIFHVKAKSIHIETEEEKEVDTDGESSLHTPCQIELLQGHFTMIYNPAVV
Download sequence
Identical sequences A0A0G8EQY8 A0A226R4S9 A0A2H2VKY1 B3ZL93 C3H7V2 F0PM59 J8GN36 J8MGM7 Q632M2
gi|52140686|ref|YP_086145.1| gi|162382769|ref|YP_897096.2| 288681.BCZK4570 412694.BALH_4390 gi|384182642|ref|YP_005568404.1| gi|376268759|ref|YP_005121471.1| WP_000167907.1.100241 WP_000167907.1.13498 WP_000167907.1.24676 WP_000167907.1.26000 WP_000167907.1.29451 WP_000167907.1.30336 WP_000167907.1.33828 WP_000167907.1.3699 WP_000167907.1.43434 WP_000167907.1.46476 WP_000167907.1.4649 WP_000167907.1.54116 WP_000167907.1.69323 WP_000167907.1.74337 WP_000167907.1.7544 WP_000167907.1.80964 WP_000167907.1.87873 WP_000167907.1.91569 WP_000167907.1.9269 WP_000167907.1.97327 WP_000167907.1.98053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]