SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 288705.RSal33209_3482 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  288705.RSal33209_3482
Domain Number 1 Region: 11-141
Classification Level Classification E-value
Superfamily Flavoproteins 3.72e-27
Family Flavoprotein NrdI 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 288705.RSal33209_3482
Sequence length 146
Comment (Renibacterium salmoninarum ATCC 33209)
Sequence
MAEGAMNPTDSRVIYFSSVSGNTHRFVDKLDVGAARLPVKTQDETLKATEPFVLVLPTYG
GETGHGAVPKQVIKFLNVAENRSLIRGVIAAGNTNFGETYCLAGDIIATKCKVPLLYQFE
LMGTPEDVDRFHQGLEQFWTRQLQAQ
Download sequence
Identical sequences A9WVH0
gi|163842200|ref|YP_001626605.1| 288705.RSal33209_3482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]