SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 289376.THEYE_A1342 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  289376.THEYE_A1342
Domain Number 1 Region: 316-466
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.62e-29
Family HD domain 0.014
Further Details:      
 
Domain Number 2 Region: 208-303
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.74e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 289376.THEYE_A1342
Sequence length 519
Comment (Thermodesulfovibrio yellowstonii DSM 11347)
Sequence
MEFLYIFIAIIFGAVAGYGVYLFHRSRLKEEKIKIHEEAQKILEDAKKEAETVKKEAHLS
AKEVIYQLKFEAEKEIKEKTKEINYQEKRLRQKEELLDRKIEQVEKREIELNKREKEIVS
KERILQEKENHYNKLISEQQQLLEKIAGMKEEEAKQELFKKVEQETRFEAARLIKRIEDE
VKQEADKKAKEILSLAVQRYASDYVVDATVTAVSLPNDEMKGRIIGREGRNIRAFESLTG
VDLVVDDTPELVILSSFDPIKREIARMALERLIVDGRIHPARIEEVVEKARRDVDIAIRD
EGEKAVFELGLSGIHPEIIKLIGRLKYRTSYGQNVLQHSKEVAWLSGIMAGELRVNVKLA
KRAGLLHDIGKAVDHEMEGSHQEIGAMLAKKYGEGEEVINAILSHHEDVEFSCVESALVA
AADALSAARPGVRRETIESYIKRLTKLEELAMSFQGVQNCYAIQAGREVRLIVRPDIVTD
EECAFIARELSRRIEKELSYPGQIKVTVIRESRFIEYAK
Download sequence
Identical sequences B5YFV4
gi|206891182|ref|YP_002249152.1| WP_012546866.1.25233 YP_002249152.1.25208 289376.THEYE_A1342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]