SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 289376.THEYE_A1690 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  289376.THEYE_A1690
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 5.09e-19
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 289376.THEYE_A1690
Sequence length 103
Comment (Thermodesulfovibrio yellowstonii DSM 11347)
Sequence
MEKKAVLEIIYRFKKAIESKGIKVDRIILFGSYATGTYHEGSDIDIVVISEDFREKSYWE
RIEILSDAIYEIFEPIEAVAMTPEEWESRDSMIVDYAEKGEVI
Download sequence
Identical sequences B5YGZ1
gi|206890773|ref|YP_002249481.1| 289376.THEYE_A1690 YP_002249481.1.25208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]