SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 289376.THEYE_A1827 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  289376.THEYE_A1827
Domain Number 1 Region: 299-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-50
Family Ribonuclease PH domain 1-like 0.0000244
Further Details:      
 
Domain Number 2 Region: 3-140
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.39e-46
Family Ribonuclease PH domain 1-like 0.0000409
Further Details:      
 
Domain Number 3 Region: 455-553
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.7e-29
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 4 Region: 141-229
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.57e-27
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 5 Region: 613-699
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-20
Family Cold shock DNA-binding domain-like 0.00014
Further Details:      
 
Domain Number 6 Region: 557-635
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.37e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 7 Region: 235-325
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000000445
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 289376.THEYE_A1827
Sequence length 710
Comment (Thermodesulfovibrio yellowstonii DSM 11347)
Sequence
MEVELEIKGKKLVLQTGIFAKQTNGSVLAKYGDTYVLCTVVAEKTPKEGLDFVPLTIDYQ
EKAYSAGKIPGGFFKREGKPTDREILVSRLIDRPVRPLFPDGFNYETQGIASVLSYGDEN
IADILSIIGISSALTISDIPFNGPVAAVRVGMVEEEFILNPDNDEAEKSILNLVVAGTEE
AVTMVEGGAAECSEETLVEALKFAHTHIKKIIALQKKLQQLSGKPKREIISLNGDEEIQK
AILNIIGGKIENALFLPKKVERQQALDELLNECLQNLNTEEFRQKLYGNFDKDISLEITN
AFDKVIKKFMRESIVKKGIRADGRKSDEIRPITCMIGILPRVHGSALFTRGETQALVATT
LGTSEDEQKVDSLEGEIFKTFMLHYNFLPFSVGEVKPLRAPGRREIGHGYLAERALSYVI
PSKDEFPYTIRVVSDILESNGSSSMATVCGATLSLMDAGVPIKAPVAGVAMGLIKEGDKT
VVLTDILGMEDHYGDMDFKVAGTEKGITAFQMDVKISGISYEIFKKALKQAKQARLFILK
KMAETISEPKKELSLYAPRIYKIQVKPEKIRDIIGTGGKVIKGIIEETGVKIDIEDKEGI
VKIASSNESAAQKAIEIIKGITQEAELGRIYMGKVTRIVDFGAFVEIMPGVEGLLHISQI
ADKRIQKVSEVLKTGEQIPVKVIEIDELGRVRLSRKEALREIENRTATKT
Download sequence
Identical sequences B5YHN2
289376.THEYE_A1827 gi|206890011|ref|YP_002249618.1| WP_012545734.1.25233 YP_002249618.1.25208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]