SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 289380.CPR_0601 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  289380.CPR_0601
Domain Number - Region: 66-121
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0333
Family Galectin (animal S-lectin) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 289380.CPR_0601
Sequence length 179
Comment (Clostridium perfringens SM101)
Sequence
MIIRLIVCILILGGLIIYRNNKLKTINLEKKKTDSKVISLLYDKLSNVLLIFFAFDMVIG
AMARDANNMTSNIWGVLTIIFCFGVFIYVTKESFKSTIIIRKNDFILFVNGEENINFHDV
KEINISNTVNKYVYLITIFLNDGREYRIKGRDQYEMNKVVRLINERIGYKALKEELAKA
Download sequence
Identical sequences Q0SVC2
289380.CPR_0601 gi|110803135|ref|YP_697928.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]