SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 289380.CPR_1652 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  289380.CPR_1652
Domain Number 1 Region: 289-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4e-47
Family Ribonuclease PH domain 1-like 0.000011
Further Details:      
 
Domain Number 2 Region: 6-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.87e-41
Family Ribonuclease PH domain 1-like 0.000023
Further Details:      
 
Domain Number 3 Region: 447-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.79e-25
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 4 Region: 136-228
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.03e-24
Family Ribonuclease PH domain 2-like 0.0047
Further Details:      
 
Domain Number 5 Region: 554-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.83e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Domain Number 6 Region: 619-701
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.87e-20
Family Cold shock DNA-binding domain-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 289380.CPR_1652
Sequence length 702
Comment (Clostridium perfringens SM101)
Sequence
MNHTHETIIAGRPMKVEFGKLGMLSDAAILMSYGDTVILTNVNASEKPREGIDFFPLSVE
YEERLYSVGKIPGGFIKREGKPSEKAILNGRAIDRPLRPLFPKGYRNDVQVVCTVVSVEN
DNLPEILAINAASMALCLSSIPFTTPVAAVQVGLIGEEFILNPTSKEREESSLQLTVCAT
KERVMMIEAGGDEIPEDTMINAIKFGFDKCQDIIKFQEEAVSMFGKEKKVPELHKVPEEI
EEAVREFAFDMISESMHITDRDERNAAMDEVKAKINEEFEEKYPDNMSDIGEAVYDMQKE
VVRHMLLKEGKRPDGRAFDEVRNIGCEVGLLPRTHGTGLFTRGLTQVMTVATLGAISEIQ
ILDGIGEEESKRYMHHYNFPAYSVGEVRPLRGPGRREIGHGALAERALEPLIPSEAEFPY
TIRLVSEVLSSNGSTSQASVCGSTLALLDAGVPIKRPAAGIAMGLITSKDLTEEEVLTDI
QGLEDFFGDMDFKVAGTEEGITSIQVDTKIKGLSEKVIHDAIYGARKARLMILDKIKECI
PAPREEVSKYAPKTSTLQIDPEKIRDVIGAGGKVINKIIADTGVKIDIKEDGLVYVSSAE
SEGVKEAVKIIEGLTKEVKSGEIYLGKVTKIAQFGAFVEVLPNKEGLVHISKLDNKRVEK
VEDIVSVGDEILVKVTEIDSQGRINLSRKDAIKEAEEENKQQ
Download sequence
Identical sequences Q0SSE0
gi|110803188|ref|YP_698967.1| 289380.CPR_1652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]