SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 289380.CPR_1842 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  289380.CPR_1842
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.08e-32
Family NPCBM-like 0.00069
Further Details:      
 
Weak hits

Sequence:  289380.CPR_1842
Domain Number - Region: 188-245
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000145
Family Type I dockerin domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 289380.CPR_1842
Sequence length 248
Comment (Clostridium perfringens SM101)
Sequence
MSFEKGLGTHADSTIIYDISGKNYDYFEAYIGLDTETGESSDGAIFKVLADNKEIYSSGV
IKPKERARLIKLDIKGASKLTLKTLKSGHDWEDHTDWANAMFTYKVKNLSEDLGLLIENS
KEVYKNSIEGFNIGEYHYGAKGELNNYIKLAEDVYKDNFSSNEKKKETIILLKNALEKFY
SLKIEENTGDFNENGSLEIGDLSIISKHYGKNSIDNSEEWENISKYDLNKDEKIDKYELD
FIIYKVLN
Download sequence
Identical sequences Q0SRV1
gi|110802952|ref|YP_699156.1| 289380.CPR_1842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]