SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28985.O94228 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.O94228
Domain Number 1 Region: 105-179
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.01e-29
Family Skp1 dimerisation domain-like 0.0000165
Further Details:      
 
Domain Number 2 Region: 7-89
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000785
Family BTB/POZ domain 0.0000517
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28985.O94228
Sequence length 182
Comment (Kluyveromyces lactis)
Sequence
MSKENQNVVLVSVEGERFVVDRKIAERSLLLKNYLQDLNSGDLHDDNDADDDEDDEEDGD
DEIVMPVPNVRSSVLQKVIEWAVHHKDSNFPDEDDDDSRKAAPVDPWDREFLKVDQEMLY
EIILAANYLNIKPLLDAGCKVVAEMIRGRTPEEIRRTFNIVNDFTPEEEAAIRRENEWAE
DR
Download sequence
Identical sequences F2Z6C8 O94228
XP_454713.1.35115 gnl|GLV|KLLA0E16941g 28985.O94228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]