SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CJK1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CJK1
Domain Number 1 Region: 127-255
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-25
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000647
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CJK1
Sequence length 459
Comment (Kluyveromyces lactis)
Sequence
MERGRTDNQYDALWGAKARENAVFEQIGLPAVINGFLAPEHETAYQVMFRIAEITAKLRS
NDLTPPSGRARSPSPPPVYDARGRRTNTKEQRYKRKLEEERHRLVEIALKMIPNFVTPDD
YRRPTRFQDKYYIPTEDYPDINFVGLLLGPRGNTLKKLQQESGCKISIRGRGSVRSGKAA
ADLPKGAMNMNEPLHCIIIADVEDKIPLGIKACESIVVKAITSPEGQNDLKRGQLRELAV
LNGTLREDNYVQTFGRKRIGIEVASDAAKRFKNAESNIHDQSTIVNTHRLTPMMQISIDG
LGGDGITATAGSNSSVGSPSSVSARSESLAAENSTSGIGITEGNLNIATPGMAPPGLSPP
GMAAPGMAAPGMAAPGLAAPGLAAPGLAAPGLAAPGLAAPGLAAPGLAAAPGNVPPGLMP
PGSVPTMNAPGLTPSTISTPSSIPSNQLPQSFTDNETNN
Download sequence
Identical sequences Q6CJK1
28985.Q6CJK1 gnl|GLV|KLLA0F18018g XP_455888.1.35115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]