SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CKH2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CKH2
Domain Number 1 Region: 334-399
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.28e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00083
Further Details:      
 
Domain Number 2 Region: 144-222
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000687
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 3 Region: 60-137
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CKH2
Sequence length 417
Comment (Kluyveromyces lactis)
Sequence
MADEEVLSLEPVSSPNSLKRKPDHETLEAGIKRVALEDNEAEPQNSELNGDGTHLTEKDS
GQVPNYINLRMLCLMKQASKVVGGKGERVNRIKSETNTRINVSDNINGVMERVIFVRGKC
EEVARAFGKIVRAINNESDDDSNERSLPLVVNLLIPHHFMGCIIGRQGSRLHEIEDLSAA
RLMASPQQLPMSNDRILSLTGVADAIHIATYYIGQTILENESKLKNKKSVFYHPGPMHSV
LVNNYQMYMIYSGGAPTNPQDITPMVAPHQEHHQYHPMDKKTMNRRTKPPVSKYPIGPQQ
SLQPYTDMVDSCKHVKIISQLQQSPISPHLVLPQEVFIDNKFVGNVIGKGGKNIQQIKQS
TGCMIKINDPVEGLDERKLVLIGTPLATQTAIMMINNRIDMDKRKRQENITIGMNDE
Download sequence
Identical sequences Q6CKH2
28985.Q6CKH2 XP_455567.1.35115 gnl|GLV|KLLA0F10703g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]