SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CL87 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CL87
Domain Number 1 Region: 151-351
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-47
Family Glycosyl hydrolases family 16 0.00044
Further Details:      
 
Weak hits

Sequence:  28985.Q6CL87
Domain Number - Region: 36-65
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.0236
Family Hevein-like agglutinin (lectin) domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CL87
Sequence length 496
Comment (Kluyveromyces lactis)
Sequence
MLSTILLWISCCTISTLAQEATRYFPETPIGCSLENNCPAEWPCCSQFGQCGTGPFCVGG
CNPRLSHDPGSCLGQPALLPRMSPSFWLQSSLEQKPALKSSFLPRVQPSMDVASNEGGEK
DLNNRGIVNFANFLISPQERIIKKMLRDYHFTYSGFVKYDAPGQLTLAMPKHTSGSLISS
TRSFLYGRATVKMKTARGRGVVTAVVLISTVGDEIDFEFIGGELHHAQSNYYHQGELNHT
RMEKLELSSDSFENTHIYEVDWDQDRINWIVDGVVARTLYKEDTWNEEKQRYEYPQTPMR
LQVSVWPGGREDADPGTIMWAGGLIDWENSPDILEKGQFYATVESIAVTPYENKFWPSIV
DELERLHLPIDANSLLDITYDYNYDKFNEHTWFEDSVIWKKGKLPYLSSLDKNGLNPGRQ
QQSLLVGKQLKQEQGDGPDQSPSNRFIQDTNKPSEKNHEEQDLLLRNALQSRDATTNGGS
SHNNRNPIKRLLNMLH
Download sequence
Identical sequences Q6CL87
XP_455302.1.35115 gnl|GLV|KLLA0F04906g 28985.Q6CL87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]