SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CPU7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CPU7
Domain Number 1 Region: 152-233
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.33e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.00024
Further Details:      
 
Domain Number 2 Region: 62-156
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.28e-21
Family Cold shock DNA-binding domain-like 0.0000421
Further Details:      
 
Weak hits

Sequence:  28985.Q6CPU7
Domain Number - Region: 3-49
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0942
Family ECR1 N-terminal domain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CPU7
Sequence length 240
Comment (Kluyveromyces lactis)
Sequence
MSKLLLPGDVISADETQSQSISAGPGIYSDPLSQEIKATHAGLEVVTPNKKGASVYVDYN
SKRYIPAVGDFVVGVIVASFGDSYRVSLCNFSNPVTLSYMAFPNASKKNKPTLKVGDLCY
ARVCSAYKELEAEIECMDSSKGQDAGFGLLDGGMTIEVSLAYARELLFNDSYPLLNILGN
LVEFEVAIGVNGIIWLKTDDVRTTLACYRSILTCQGVSPAQFDKTIKSIFNDTLKSTDEK
Download sequence
Identical sequences Q6CPU7
XP_454042.1.35115 gnl|GLV|KLLA0E02091g 28985.Q6CPU7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]