SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CQ82 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CQ82
Domain Number 1 Region: 179-258
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000424
Family Eukaryotic type KH-domain (KH-domain type I) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CQ82
Sequence length 271
Comment (Kluyveromyces lactis)
Sequence
MELDSLALRYVTNTSLCSTKAMQSFTPACGSNHNDKHFGQSQNRVQLLIGKWLLTRLKAE
NVSFEKEEVEVYDNANYSIWYSGEVKILSSILDCQGFILMVLISDFIQIRRNRLRSNVEI
SGNLILLEGSIQDISLDIYMLSSVNKDLYSNNTNVFESCIPGKTDNIFQIETEAENVTPT
EESLVLSRLQVSYLIGHEGQRIEFLRSEAGVNIKIMPIEKRLSNFDLKNPRNTTQEVRIY
GKLQNVHRCIVLIEQHLRMFSVPRPRDNRFF
Download sequence
Identical sequences Q6CQ82
gnl|GLV|KLLA0D19063g 28985.Q6CQ82 XP_453907.1.35115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]