SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CR01 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CR01
Domain Number 1 Region: 114-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.62e-27
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 855-1145
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000000000432
Family p120GAP domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CR01
Sequence length 1494
Comment (Kluyveromyces lactis)
Sequence
MSVLTGSPGKSDSINTRMQEYMKNINKDSQPVLKQISSSRINSNSNLKGILSSTKSPKNT
YSGSPGKENFNNVTAELSFILKNSPTKPSYFSASGNNVNGNNSSPSKLSSSKDNDYQEFL
VRIEEAKQWIEAIIHEELPSALELATTKCMSDGVYLAKLVATVKPELVKKIIPTGDRLMY
AHTQNINAFLELVNYIAVPDLFKFELNDLYDRKNIPKVFETIHATASLLSAQYGTIIPQM
QNLTGQIDVSIDDIKLCQRKVPGVHAFRSFNQFGSKPSSPKKSPQKGLLDSAVLQSPVKL
KTEPEVCIPESPKTPTRYSSAIVHDIRQFNPSLSETKPLSLSYPTESSPQRLKYSPDRTF
SYYSPGVSRRLSYRTEDIGYFNRKRHQWNYDFDYYDTYRYGSTQYSPKRRERMTETEFLD
TVTHLQALLRGLNTRYDVHLKIITLKHSNTRFAELQALCKGAVIRGQHQNFVQNHKPNEA
LVTLQARLRGSIQRDVFDHFRLRLIKRENYILYLKTQLKGSAQRKLTQEKLRYKSIYGDT
FSVLQAVIRAKLQRGNFMSYHNISNIVSSEASALQALSRGRIVRLRMMEASSGDLQIKLQ
ALLRGAFQRSKLQRVKEVMSCDQFQNFGPILKGYIVARRYTDAPSKVANEIVSFNAVVKG
MLTRFAMELIIDIAEQNNIDSLQSKVLGYLIRKRVSQKKSFYKMRESEIIIIQKNIRRYQ
LQNAYKVLMSTGSPKLSTVRKFVHILNQSDNELFSANLQKLKANINDVNDEVGELQESLR
KKVLMKDSLEKRRIDVCKFLTPAGRQQLEIQFNAISSDNISANLKSLYGKAGFLLQVDSF
YWHLLAKGDPRFCVTNLPKLFAPIRGAIGDRENSLLIKVIGDLLVEEIDESSTLNDFLVN
DDAVWIQVLQNYLTSFRSKEILTAFAQLYKYLDSNAIDFESDPSKIYAKLHPTAPPQLAH
EAIEDSSTSKRFIKNMTSLWGAVELVCAVLDHIVSSTRNDLKYLASRAYRSSANKDTEES
SALSAISKIVVDNFIFVALMKRSDFSSSTVGLNYDEKARVLTETLKVIFALKTFDGYFSP
LNQYLVQSHNQFSDILTELLMEPEESKEYETMVYKDMANNSKPSLMIYHQSFIKILEKLE
GTLEELPHDDPMVKILSKIQIEFDKTSVNGQSQLTISLDPSAYKVTLNNSRSDLMYTEAK
QGLCYLMQVEEVNSNLTDLLVSEVLPEDEIAFQQLIAQNPSIANTLSEKHGDIINYAEFK
KFLMYRIKELTVLGIIDKSNDYQFLLVDIANTIKTRSCIKGLNRSEMELMTSVYDSLNDK
LRNTKLLLDAMDTAITKSIKEIQSLHDYTPAKKSGFGHKLKDVYQKNHKKSHEAEAGMNY
KWSNKQLFELGVLSKVTGNGAKNSSVSFFGSSGSKSQYVDLKFSTRDGEVFGIELIDNKN
KFDSNLQSVVKFSELIEKEAADRHSTISILGRKEKMVLNVGKLLDLLVDSFFRF
Download sequence
Identical sequences Q6CR01
28985.Q6CR01 gnl|GLV|KLLA0D12914g XP_453638.1.35115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]