SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CRD0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CRD0
Domain Number 1 Region: 163-347
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-17
Family SPRY domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CRD0
Sequence length 466
Comment (Kluyveromyces lactis)
Sequence
MNLSLVARHGHKSKMAHKHHGDSAHVSEGPSDPDVDMDLIVFTMMFMFLSYLLSILVYFV
TRWLVKRLFTARISLHEEGTMNGGQSDLSEDRYLDDESEVKEFLQNLSPKEQFYYKQGEE
YVKQNPPLLVPYLPNDPENREEVIPDPIVNEQTLQFIEEEGAAAWEFQADPNLPNDTVMI
QERTELTFLNFSYDASVMTTLPIPRLNKVYYYECKIFELNQGKNHLSDNEMISIGLSTSP
YPYFRLPGRHHHSISYDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFF
THNGKKLNEKKVGGHIKGWKLKYLYPIVGSNIPCKIHVNFGTYGFVYIEANVKKWGYSKN
AGIKLPPPSYEDYDQDVLLESAFEDDVSDSESITSDSINEQITDQSGNILPPPPGFEFST
SVASDIPVESITMHSLPAEPPNYSADEDEEHNVEDNTIANQFVATT
Download sequence
Identical sequences Q6CRD0
28985.Q6CRD0 XP_453509.1.35115 gnl|GLV|KLLA0D10065g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]